PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00039552001
Common NameGSBRNA2T00039552001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 419aa    MW: 47230.5 Da    PI: 5.0311
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00039552001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81e-092663031954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk+++L+++qV +WF N R +
  GSBRNA2T00039552001 266 FEHflHPYPKESEKMMLAKQTRLSKNQVANWFINARVR 303
                          554459******************************88 PP

2BELL112.52.3e-36156227172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk kLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS hFr+ +dai+e+i
  GSBRNA2T00039552001 156 ERQELQSKKDKLLTMVDEVDKRYNQYYHQMEALASSFEVVAGFGSAKPYTSVALNRISCHFRSFRDAIKEHI 227
                          79*******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-4591225IPR006563POX domain
PfamPF075262.1E-4496223IPR006563POX domain
SMARTSM003892.5E-7250311IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-25257313IPR009057Homeodomain-like
CDDcd000861.21E-9258308No hitNo description
SuperFamilySSF466896.42E-16258314IPR009057Homeodomain-like
PfamPF059201.9E-17264303IPR008422Homeobox KN domain
PROSITE profilePS5007111.531266307IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MVFIPPTGLQ NLNGDVPVSS SELTFRDGQG LSLSLLGTQI SLPSFHYQQY QSGFTTNPPI  60
SVQETPPFSK EMLLLGQSDP SSGYAEVYNN YNMSSVLRSR YLKPAQVLLD EVVSVEKELN  120
QMRKKKKGEA FNNSANETEG GGGFGGEISI ELSTIERQEL QSKKDKLLTM VDEVDKRYNQ  180
YYHQMEALAS SFEVVAGFGS AKPYTSVALN RISCHFRSFR DAIKEHIQVI REKLGEKGGE  240
LSLDEQQGGE RIPRLSSVSA LRAWLFEHFL HPYPKESEKM MLAKQTRLSK NQVANWFINA  300
RVRLWKPMIE EMYKEEFGDD ASELLTSKSP SSTNQEDSSS QQQEPENTTN VAFSSEPKPD  360
CTSANEDDPQ LHQMNRSADY DSLVNYHGFG VDDYRYIDGN NQQESRFSNG HHLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-14248311163Homeobox protein Meis2
3k2a_B5e-14248311163Homeobox protein Meis2
4xrm_A4e-14253311663Homeobox protein Meis2
4xrm_B4e-14253311663Homeobox protein Meis2
4xrs_A4e-14253310258Homeobox protein Meis1
4xrs_B4e-14253310258Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.200692e-58leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00039552001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705081e-116AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729468.10.0PREDICTED: BEL1-like homeodomain protein 10 isoform X2
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A078JF980.0A0A078JF98_BRANA; BnaC08g19170D protein
STRINGBra016497.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]